PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071244.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TCP
Protein Properties Length: 278aa    MW: 29855.4 Da    PI: 10.4351
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071244.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP113.33.2e-3555140287
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                     a+k+++++++h kv+gR+RR+R++a+ aar+F+L++eLG+++d++ti+WLlqqa+p+i+++tgt++++as+ +a+  s+s++ ss 
  XP_011071244.1  55 APKRSSNKDRHKKVEGRGRRIRIPALSAARIFQLTRELGHKTDGETIQWLLQQAEPSIIAATGTGTIPASAITAAGASVSEQGSSV 140
                     789******************************************************************88844444444443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.1E-2960154IPR005333Transcription factor, TCP
PROSITE profilePS5136925.68561115IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MSPSSIKRPH FSALLMERKS SKHQQKIPQD VATSFSQKNM ALDKLEDDSK KRQLAPKRSS  60
NKDRHKKVEG RGRRIRIPAL SAARIFQLTR ELGHKTDGET IQWLLQQAEP SIIAATGTGT  120
IPASAITAAG ASVSEQGSSV SSGFYSRLGE TVPGVGLRPN LSMMGEDILG RSMGVWPSFS  180
GFGSGILQNS SVLSSNPVAN LSRVSKHGFQ AFEFPGSVSS GQMPGLELGL SQEGQIGGLN  240
LQTFTQFYQQ IGQTGDCGGS TNHQEQDHGK ENSQGSRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071244.10.0PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD53e-57TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A068UY755e-95A0A068UY75_COFCA; Uncharacterized protein
STRINGPOPTR_0003s16630.11e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.16e-55TCP family protein